Eternal ResearchStarts here

Join for 10% off + access to COA-backed compounds

Every batch is rigorously tested to guarantee quality.

Eternal Peptides
Fourth of July Sale! Use code: USA20 for 20% off your order! Ends in: --:--:--:--
IGF-1 LR3
IGF-1 LR3
IGF-1 LR3
IGF-1 LR3
thumb
thumb
thumb
zoom image

Satisfaction
Guaranteed

All products are handled with strict quality standards to ensure consistent research-grade excellence.

Secure
Ordering

Our checkout is SSL encrypted and completely secure.

Third-party
Tested

Our products are verified by independent third party laboratories to meet quality standards.

Batch & Lot
Tracking

All product batches and lots are assigned unique identifiers and tied to publicly posted lab reports.

Endless
Commitment

We are committed to helping our customers. If you have any questions or concerns, please reach out through our Contact Us page.

IGF-1 LR3

$99.99

Purchase & earn 100 points!
Orders processed within 24 hours · Free shipping on orders over $250

Discount per Quantity

QuantityDiscountPrice
5 - 105%$94.99
11 - 2010%$89.99
21+15%$84.99

Rigorous Third-Party Testing

Every batch of our research chemicals and peptides undergoes
third-party testing.

Disclaimer: This product is intended solely for laboratory research purposes. It is not suitable for consumption by humans, nor for medical, veterinary, or household purposes. Kindly review our Terms & Conditions before making a purchase.

Always quality-tested, verified with third-party COAs

At every step, we prioritize quality by conducting rigorous third-party testing on all our products. These tests focus on five key characteristics — identity, purity, sterility, endotoxin levels, and heavy metal content — ensuring that each product meets the highest standards of quality, with independent third-party Certificates of Analysis (COAs) to verify our commitment to excellence.

Identity Test

Identity testing ensures that the product contains the correct ingredient as labeled, verifying its authenticity and matching it to established reference standards.

Purity Test

Purity and concentration testing verifies that the ingredient is present in the correct amount, with a purity of 99% or higher to meet stringent quality standards.

Sterility Test

Sterility testing ensures that the product is completely free from bacteria, fungi, and other microorganisms.

Endotoxin Test

Endotoxicity testing specifically detects and quantifies lipopolysaccharides (LPS), components of bacterial cell walls, to ensure the product is free from endotoxins.

Heavy Metals Test

Heavy metals testing ensures that the product is free of heavy metals such as lead, arsenic, mercury, cadmium, and other heavy metals.

Identity Test

Identity testing ensures that the product contains the correct ingredient as labeled, verifying its authenticity and matching it to established reference standards.

Purity Test

Purity and concentration testing verifies that the ingredient is present in the correct amount, with a purity of 99% or higher to meet stringent quality standards.

Sterility Test

Sterility testing ensures that the product is completely free from bacteria, fungi, and other microorganisms.

Endotoxin Test

Endotoxicity testing specifically detects and quantifies lipopolysaccharides (LPS), components of bacterial cell walls, to ensure the product is free from endotoxins.

Heavy Metals Test

Heavy metals testing ensures that the product is free of heavy metals such as lead, arsenic, mercury, cadmium, and other heavy metals.

*Disclaimer: This product is intended solely for laboratory research purposes. It is not suitable for consumption by humans, nor for medical, veterinary, or household purposes.Kindly review our Terms & Conditions before making a purchase.

Shop IGF-1 LR3 1mg from Eternal Peptides, a trusted supplier of research compounds with rigorous independent quality verification across every batch. Each 1mg lyophilized unit is independently tested for 99%+ purity and identity by third-party labs, with Certificates of Analysis available for full transparency. Competitively priced with fast, secure USPS shipping free on orders over $200. Sold for research use only.

IGF-1 LR3 Peptide Characteristics

Property Description
Name Insulin-Like Growth Factor-1 Long R3 (IGF-1 LR3); recombinant 83–amino acid analog of human IGF-1 with Arg substitution at position 3 and N-terminal 13–amino acid extension
Sequence MFPAMPLLSLFVNPSRGVDEPSFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular Weight 9,117.5 g/mol
Molecular Formula C400H625N111O116S9
PubChem CID n/a (CAS: 946870-92-4)
Structural Class Recombinant growth factor analog; IGF family peptide hormone derivative
Product Form Lyophilized powder supplied in 1 mg research vials
Purity Typically ≥99%, verified via lot-specific Certificate of Analysis (COA)
Solubility Soluble in sterile laboratory-grade water or dilute acetic acid after reconstitution; gentle mixing recommended
Stability Stable in lyophilized form under refrigerated or frozen storage; reconstituted solutions require cold storage and minimized freeze–thaw cycles

Handling & Storage Guidelines

Proper handling of IGF-1 LR3 is essential to maintain structural integrity and ensure reproducible laboratory results. As a recombinant growth factor analog supplied in lyophilized form, it should be stored and reconstituted under controlled research conditions.

  • Storage (Lyophilized): Store unopened vials refrigerated at 36–46°F (2–8°C). For extended storage, freezing at or below 0°F (−18°C) is recommended. Protect from direct light, heat, and moisture.
  • Reconstitution: Reconstitute using sterile laboratory-grade water or bacteriostatic water under aseptic conditions. Introduce diluent slowly and avoid agitation; gently swirl until fully dissolved. For the best stability, purity, and consistent results, get bacteriostatic water with your IGF-1 LR3 order.
  • Aliquoting & Freeze–Thaw: If repeated use is anticipated, aliquot into sterile microtubes to minimize repeated freeze–thaw cycles, which may compromise structural stability.
  • Working Solution Storage: Store reconstituted solutions at 36–46°F (2–8°C) for short-term use. For longer-term storage, aliquots may be frozen at or below 0°F (−18°C) according to institutional guidelines.
  • Laboratory Compliance: Handle with appropriate personal protective equipment and in accordance with institutional biosafety protocols. This material is designated strictly for research use only.

COA / Quality Assurance

Each lot of IGF-1 LR3 is supported by a lot-specific Certificate of Analysis (COA) to ensure transparency, traceability, and research reproducibility. Eternal Peptides works with independent third-party analytical laboratories, including Janoshik, to provide objective verification of identity and purity standards.

COAs are generated for every production batch and typically include:

  • Peptide Identity: Confirmation via high-performance liquid chromatography (HPLC) and/or mass spectrometry to verify molecular weight and structural conformity.
  • Purity Analysis: Quantitative purity assessment, commonly ≥99%, based on chromatographic profiling.
  • Sterility Testing (where applicable): Evaluation for microbial contamination depending on product format and handling expectations.
  • Endotoxin Levels: Analytical measurement to support use in sensitive laboratory environments.
  • Storage & Handling Guidance: Recommended conditions to preserve peptide stability and integrity.

All COAs are lot-specific, fully traceable, and accessible through the Lab Tests page to assist with documentation, audit requirements, and experimental consistency.

Legal / Regulatory Disclaimer

IGF-1 LR3 is supplied strictly for laboratory research use only. It is not approved for human or veterinary use, clinical administration, therapeutic applications, or diagnostic procedures of any kind. The safety, efficacy, and appropriate dosing of IGF-1 LR3 in humans or animals have not been established.

Purchasers are responsible for ensuring compliance with all applicable local, state, and federal laws, as well as institutional biosafety and research-use regulations. This material must be handled exclusively by qualified professionals in controlled laboratory environments. Misrepresentation of intended use or diversion for unauthorized purposes may result in regulatory enforcement or legal consequences.

0