Join for 10% off + access to COA-backed compounds
Every batch is rigorously tested to guarantee quality.
All products are handled with strict quality standards to ensure consistent research-grade excellence.
Our checkout is SSL encrypted and completely secure.
Our products are verified by independent third party laboratories to meet quality standards.
All product batches and lots are assigned unique identifiers and tied to publicly posted lab reports.
We are committed to helping our customers. If you have any questions or concerns, please reach out through our Contact Us page.
$99.99
| Quantity | Discount | Price |
|---|---|---|
| 5 - 10 | 5% | $94.99 |
| 11 - 20 | 10% | $89.99 |
| 21+ | 15% | $84.99 |
Every batch of our research chemicals and peptides undergoes third-party testing.
Disclaimer: This product is intended solely for laboratory research purposes. It is not suitable for consumption by humans, nor for medical, veterinary, or household purposes. Kindly review our Terms & Conditions before making a purchase.
At every step, we prioritize quality by conducting rigorous third-party testing on all our products. These tests focus on five key characteristics — identity, purity, sterility, endotoxin levels, and heavy metal content — ensuring that each product meets the highest standards of quality, with independent third-party Certificates of Analysis (COAs) to verify our commitment to excellence.
*Disclaimer: This product is intended solely for laboratory research purposes. It is not suitable for consumption by humans, nor for medical, veterinary, or household purposes.Kindly review our Terms & Conditions before making a purchase.
Shop IGF-1 LR3 1mg from Eternal Peptides, a trusted supplier of research compounds with rigorous independent quality verification across every batch. Each 1mg lyophilized unit is independently tested for 99%+ purity and identity by third-party labs, with Certificates of Analysis available for full transparency. Competitively priced with fast, secure USPS shipping free on orders over $200. Sold for research use only.
| Property | Description |
| Name | Insulin-Like Growth Factor-1 Long R3 (IGF-1 LR3); recombinant 83–amino acid analog of human IGF-1 with Arg substitution at position 3 and N-terminal 13–amino acid extension |
| Sequence | MFPAMPLLSLFVNPSRGVDEPSFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular Weight | 9,117.5 g/mol |
| Molecular Formula | C400H625N111O116S9 |
| PubChem CID | n/a (CAS: 946870-92-4) |
| Structural Class | Recombinant growth factor analog; IGF family peptide hormone derivative |
| Product Form | Lyophilized powder supplied in 1 mg research vials |
| Purity | Typically ≥99%, verified via lot-specific Certificate of Analysis (COA) |
| Solubility | Soluble in sterile laboratory-grade water or dilute acetic acid after reconstitution; gentle mixing recommended |
| Stability | Stable in lyophilized form under refrigerated or frozen storage; reconstituted solutions require cold storage and minimized freeze–thaw cycles |
Proper handling of IGF-1 LR3 is essential to maintain structural integrity and ensure reproducible laboratory results. As a recombinant growth factor analog supplied in lyophilized form, it should be stored and reconstituted under controlled research conditions.
Each lot of IGF-1 LR3 is supported by a lot-specific Certificate of Analysis (COA) to ensure transparency, traceability, and research reproducibility. Eternal Peptides works with independent third-party analytical laboratories, including Janoshik, to provide objective verification of identity and purity standards.
COAs are generated for every production batch and typically include:
All COAs are lot-specific, fully traceable, and accessible through the Lab Tests page to assist with documentation, audit requirements, and experimental consistency.
IGF-1 LR3 is supplied strictly for laboratory research use only. It is not approved for human or veterinary use, clinical administration, therapeutic applications, or diagnostic procedures of any kind. The safety, efficacy, and appropriate dosing of IGF-1 LR3 in humans or animals have not been established.
Purchasers are responsible for ensuring compliance with all applicable local, state, and federal laws, as well as institutional biosafety and research-use regulations. This material must be handled exclusively by qualified professionals in controlled laboratory environments. Misrepresentation of intended use or diversion for unauthorized purposes may result in regulatory enforcement or legal consequences.



